DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GstZ2

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster


Alignment Length:191 Identity:45/191 - (23%)
Similarity:85/191 - (44%) Gaps:41/191 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QPLKFYFDFLNQSSRALYILLEASKIPFEAIPISMLK--GEHLTGEFRDNVNRFRKLPAITDHGY 65
            ||: .|..:.:..|..:.|.:...:||::..|||::|  ||....|:|: ||...::||:...|:
  Fly    15 QPI-LYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYRE-VNPMEQVPALQIDGH 77

  Fly    66 QLSENVAIFRHLAREKLVPEHWYPRRHL------GRSRIDEYL--------AWQQTNMGVATTEY 116
            .|.|:|||..:|       |...|:|.|      .|:::.|.:        ..|...:.:...|.
  Fly    78 TLIESVAIMHYL-------EETRPQRPLLPQDVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEE 135

  Fly   117 FQQKWLVPYLQKTRPADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEI 177
            .:::|          |.:.:....:.:|..|:      .::.|:.:||.||.||...:.::
  Fly   136 KKKEW----------AQHWITRGFRAVEKALS------TSAGKYCVGDEISMADCCLVPQV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 24/76 (32%)
GST_C_Theta 95..220 CDD:198292 15/91 (16%)
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 25/82 (30%)
maiA 17..221 CDD:273527 43/189 (23%)
GST_C_Zeta 104..217 CDD:198300 15/93 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459995
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.