DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and gstt1b

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:202 Identity:72/202 - (35%)
Similarity:110/202 - (54%) Gaps:1/202 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSE 69
            |:.|.|..:|..|::||..:.:.|.|:...||:.:|.....|| ..:|..||.|.|.|..:.|:|
Zfish     3 LEIYLDLFSQPCRSVYIFAKKNNIQFDYKKISLFEGYQYGEEF-GKINPLRKFPTIKDGDFCLAE 66

  Fly    70 NVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRPADN 134
            :|||..:||.:...|:||:|.....|:|::|||:||.|::.:...:....|.|:|.:........
Zfish    67 SVAIMIYLADKFHTPDHWFPADLQKRARVNEYLSWQHTSIRMHGAKIIWFKILIPEVLGAEVPKE 131

  Fly   135 AVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNRNKLARWYE 199
            .:..|.:.|...|..|:..||..:.|::||.||.|||.||.||.||.:.|.:.|:||.||..|.:
Zfish   132 KMENAEENLNVALQLFQDKFLQDKPFIVGDQISLADLVAIVEIMQPFAAGMDVFENRPKLKAWKD 196

  Fly   200 TVREELG 206
            .||..:|
Zfish   197 RVRVAIG 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 27/74 (36%)
GST_C_Theta 95..220 CDD:198292 41/112 (37%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 69/196 (35%)
GST_N_Theta 3..78 CDD:239348 27/75 (36%)
GST_C_Theta 91..217 CDD:198292 41/113 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582837
Domainoid 1 1.000 57 1.000 Domainoid score I10844
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H133944
Inparanoid 1 1.050 160 1.000 Inparanoid score I4211
OMA 1 1.010 - - QHG54888
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm6596
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43917
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.