DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GstO3

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster


Alignment Length:221 Identity:48/221 - (21%)
Similarity:86/221 - (38%) Gaps:53/221 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKFY-FDFLNQSSRALYILLEASKIPFEAIPISML-KGEHLTGEFRDNVNRFRKLPA---ITDHG 64
            |:.| ..|...:.|| :::|.|..:|:.::.|::. |.|.|.     .|:...|:||   :.:.|
  Fly    22 LRLYSMRFCPYAQRA-HLVLNAKNVPYHSVYINLTEKPEWLV-----EVSPLLKVPALQLVAEKG 80

  Fly    65 Y-QLSENVAIFRHLAREKLVPEH-WYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQ 127
            . .|.|::.|..:|  :...||: ..|:..|.|:                     |.|.|:....
  Fly    81 EPSLIESLIIAEYL--DDKYPENPLLPKDPLKRA---------------------QDKILLERFS 122

  Fly   128 KTRPADNAVNLASKQLEH---TLNEF-EQLFLNSRKFMMGDNISYAD---------LSAICEIDQ 179
            ....|...:.:....||.   .|:.| |:|......:..|:...:.|         ||.| |:..
  Fly   123 SITSAFINILVQGTGLEDYWTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVI-ELKL 186

  Fly   180 PKSIGYNAFQNR-NKLARWYETVREE 204
            .|.  ||..::| .|:.:|...::.:
  Fly   187 QKE--YNFNESRFPKITKWIALLKAD 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 21/80 (26%)
GST_C_Theta 95..220 CDD:198292 23/124 (19%)
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 21/80 (26%)
GstA 22..209 CDD:223698 48/218 (22%)
GST_C_Omega 109..230 CDD:198293 24/126 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459967
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.