DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GstE4

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster


Alignment Length:231 Identity:59/231 - (25%)
Similarity:105/231 - (45%) Gaps:44/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSENVAIFRHLARE 80
            :||..:.|:|..:|||.:.:::.:.|:.:.:| ...|....:|.:.|....:.::.||..:|. |
  Fly    15 TRACLLTLKALDLPFEFVFVNLFEKENFSEDF-SKKNPQHTVPLLQDDDACIWDSHAIMAYLV-E 77

  Fly    81 KLVP-EHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRPA--DNAVNLASKQ 142
            |..| :..||:..|.|:::|:.:.::.   ||......:        :.|||.  .....|...|
  Fly    78 KYAPSDELYPKDLLQRAKVDQLMHFES---GVIFESALR--------RLTRPVLFFGEPTLPRNQ 131

  Fly   143 LEHTLN--EFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNRN-----KLARWYET 200
            ::|.|.  :|.:.||:...|:.||.::.||.|.:..|   .|||  .|...:     |:|.|.|.
  Fly   132 VDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTI---TSIG--VFLELDPAKYPKIAAWLER 191

  Fly   201 VREELGPHYKEVLGEFEAKLKGSGSGQQQGVAQAVK 236
            ::|.  |:|:|..|              :|.||.|:
  Fly   192 LKEL--PYYEEANG--------------KGAAQFVE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 15/63 (24%)
GST_C_Theta 95..220 CDD:198292 34/133 (26%)
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 15/63 (24%)
GstA 6..196 CDD:223698 51/200 (26%)
GST_C_Delta_Epsilon 91..209 CDD:198287 37/149 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459982
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.