DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GstE3

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster


Alignment Length:218 Identity:52/218 - (23%)
Similarity:100/218 - (45%) Gaps:39/218 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSENVAIFRHLAREK 81
            |::.:.|.|..:.|:...:::::.|||..||. .:|....:||:.|:|:.|:::.||..:|..:.
  Fly    16 RSVLLTLRALNLDFDYKIVNLMEKEHLKPEFL-KINPLHTVPALDDNGFYLADSHAINSYLVSKY 79

  Fly    82 LVPEHWYPRRHLGRSRIDEYLAWQQ---TNMGVATTEYFQQKWLVPYLQKTRPADNAVNLASKQL 143
            ...:..||:....|:.:|:.|.:..   |:.|.|.|  |...|           :|...:...::
  Fly    80 GRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAIT--FPLFW-----------ENKTEIPQARI 131

  Fly   144 E------HTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAF-----QNRNKLARW 197
            :      .:||    |||.:..::.|||::.||...|..:     .|:..|     ....:||.|
  Fly   132 DALEGVYKSLN----LFLENGNYLAGDNLTIADFHVIAGL-----TGFFVFLPVDATKYPELAAW 187

  Fly   198 YETVREELGPHYKEVLGEFEAKL 220
            .:.::|.  |:|:|..|...|::
  Fly   188 IKRIKEL--PYYEEANGSRAAQI 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 18/62 (29%)
GST_C_Theta 95..220 CDD:198292 32/138 (23%)
GstE3NP_611325.2 GstA 4..195 CDD:223698 47/203 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/61 (30%)
GST_C_Delta_Epsilon 91..208 CDD:198287 32/140 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459983
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.