DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GstE2

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster


Alignment Length:225 Identity:53/225 - (23%)
Similarity:97/225 - (43%) Gaps:39/225 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQPLKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGY 65
            ||..|..|...::...||..:.|.|..:.:|...:.:|.|:|....|... |....:|.:.|:|.
  Fly     1 MSDKLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKK-NPQHTVPLLEDNGA 64

  Fly    66 QLSENVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNM-----GVATTEYFQQKWLVPY 125
            .:.::.||..:|..:....:..|||..:.|:::|:.|.:..:.:     .|:...:.:|..||| 
  Fly    65 LIWDSHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVP- 128

  Fly   126 LQKTRPADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYAD---------LSAICEIDQPK 181
               ....|| :..|...||:        ||....::.|..::.||         |:|:.::|:.|
  Fly   129 ---KEKVDN-IKDAYGHLEN--------FLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELK 181

  Fly   182 SIGYNAFQNRNKLARWYETVREELGPHYKE 211
                     ..|:|.|:|.:.:.  |||:|
  Fly   182 ---------YPKVAAWFERLSKL--PHYEE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 18/74 (24%)
GST_C_Theta 95..220 CDD:198292 30/131 (23%)
GstE2NP_611324.1 GstA 5..196 CDD:223698 47/215 (22%)
GST_N_Delta_Epsilon 5..78 CDD:239343 18/73 (25%)
GST_C_Delta_Epsilon 94..209 CDD:198287 30/131 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459985
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.