DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GstE1

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster


Alignment Length:221 Identity:48/221 - (21%)
Similarity:95/221 - (42%) Gaps:31/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SQPLKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQ 66
            |..:..|...|:...|.:.:.|:...:.:|...:::..||||:.|:... |....:|.:.|:|..
  Fly     3 SSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKK-NPQHTVPMLDDNGTF 66

  Fly    67 LSENVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRP 131
            :.::.||..:|..:....:..||:....|:.:::.|.:..:.:..:.....:..|:....:..:.
  Fly    67 IWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQE 131

  Fly   132 ADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLS---------AICEIDQPKSIGYNA 187
            ..:||:...|.||        .||.:..::.||:::.||||         |..:||........|
  Fly   132 KLDAVHQGLKLLE--------TFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTA 188

  Fly   188 FQNR-NKLARWYETVREELGPHYKEV 212
            :.:| |||            |:|||:
  Fly   189 WLDRLNKL------------PYYKEI 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 17/74 (23%)
GST_C_Theta 95..220 CDD:198292 28/128 (22%)
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 17/73 (23%)
GstA 8..197 CDD:223698 43/209 (21%)
GST_C_Delta_Epsilon 94..210 CDD:198287 28/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459989
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.