DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GstS1

DIOPT Version :10

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001261040.1 Gene:GstS1 / 36927 FlyBaseID:FBgn0010226 Length:250 Species:Drosophila melanogaster


Alignment Length:79 Identity:14/79 - (17%)
Similarity:37/79 - (46%) Gaps:19/79 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQPLKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGY 65
            :::||::.|.:.||.    |..:..::..:.|:..:|..|:               :|.:...|.
  Fly    60 LAEPLRYLFAYGNQE----YEDVRVTRDEWPALKPTMPMGQ---------------MPVLEVDGK 105

  Fly    66 QLSENVAIFRHLAR 79
            ::.:::::.|.||:
  Fly   106 RVHQSISMARFLAK 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 13/75 (17%)
GST_C_Theta 95..220 CDD:198292
GstS1NP_001261040.1 GST_N_Sigma_like 50..119 CDD:239337 13/77 (17%)
GST_C_Sigma_like 129..232 CDD:198301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.