DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GstE14

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster


Alignment Length:231 Identity:49/231 - (21%)
Similarity:92/231 - (39%) Gaps:36/231 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQPLK-FYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHG 64
            ||||.. .|:|..:...|:..:|::...|..|...:::.|||....:|. .:|....:|.:....
  Fly     1 MSQPKPILYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFL-ALNPQHSVPTLVHGD 64

  Fly    65 YQLSENVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKT 129
            ..|:::.||..|||.:.......:|:.|..|.::...|.::.:.:....:::..        ...
  Fly    65 LVLTDSHAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMS--------ATV 121

  Fly   130 RPADNAVNLASKQLEHTLNE---FEQLFLNSRKFMMGDNISYADLSAICEIDQ-----PKSIGYN 186
            |.....|::|..  |..|.|   ..:.:|.:..||.|..::.||||.:..:..     |.|    
  Fly   122 RQGFANVDVAHH--ERKLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPLS---- 180

  Fly   187 AFQNRNKLARWYETVREELGPHYKEVLGEFEAKLKG 222
               ...:|.||:..:::         |..:||...|
  Fly   181 ---QFPRLRRWFTAMQQ---------LDAYEANCSG 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 18/75 (24%)
GST_C_Theta 95..220 CDD:198292 24/132 (18%)
GstE14NP_610855.1 GstA 6..200 CDD:223698 42/220 (19%)
GST_N_Delta_Epsilon 6..79 CDD:239343 17/73 (23%)
GST_C_Delta_Epsilon 94..209 CDD:198287 25/137 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
54.820

Return to query results.
Submit another query.