DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GstT1

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster


Alignment Length:213 Identity:84/213 - (39%)
Similarity:133/213 - (62%) Gaps:4/213 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQPLKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGY 65
            ||:.:|:|:|||:|.||||:|.::..|.|||..|:::.|.|.||.|:| ::|||:|:|||.|..:
  Fly     1 MSKAIKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYR-SINRFQKVPAIVDGKF 64

  Fly    66 QLSENVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYL-QKT 129
            ||.|:|:|.|:||.:.:..|..||:....|:|:||:|.||..|:.:..:.:|:|.||:|.. ...
  Fly    65 QLGESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAP 129

  Fly   130 RPADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNR-NK 193
            .|...:|....|.:|..|...|:|:| .:.|::||.::.||:....||:|.|...||..:.: .|
  Fly   130 APKPESVKKLIKDVESNLGLLERLWL-EKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFPK 193

  Fly   194 LARWYETVREELGPHYKE 211
            :|:|.|.||:...|:|.|
  Fly   194 VAKWMERVRDATNPYYDE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 38/74 (51%)
GST_C_Theta 95..220 CDD:198292 41/119 (34%)
GstT1NP_610509.2 GstA 5..204 CDD:223698 79/200 (40%)
GST_N_Theta 5..80 CDD:239348 38/75 (51%)
GST_C_Theta 93..218 CDD:198292 41/120 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459965
Domainoid 1 1.000 64 1.000 Domainoid score I3657
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I2004
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54888
OrthoDB 1 1.010 - - D106508at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm6596
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43917
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.910

Return to query results.
Submit another query.