DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GstT3

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster


Alignment Length:224 Identity:82/224 - (36%)
Similarity:141/224 - (62%) Gaps:1/224 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQPLKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGY 65
            ||.|:::|:|.::|.||||:|:...|.:|||...:::..|||||.:|:..:|||:::|.|.|:||
  Fly    41 MSAPIRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGY 105

  Fly    66 QLSENVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTR 130
            :|:|:|||.|:|:.:..:|||.||:..:.:||:||:|.||..::.:....||:..||.|.|....
  Fly   106 KLAESVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRT 170

  Fly   131 PADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNRNKLA 195
            |::..:.....|:|..|:..|:::|..:.|:.|.:::.||:.|.|||:|.:...|:......|:.
  Fly   171 PSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYPKIR 235

  Fly   196 RWYETVREELGPHYKEVLGEFEAKLKGSG 224
            .|.:.||:...|:| :|..||..|:.|:|
  Fly   236 AWLKRVRQSCNPYY-DVAHEFVYKISGTG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 33/74 (45%)
GST_C_Theta 95..220 CDD:198292 38/124 (31%)
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 33/75 (44%)
GstA 47..243 CDD:223698 70/195 (36%)
GST_C_Theta 135..259 CDD:198292 38/124 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459963
Domainoid 1 1.000 64 1.000 Domainoid score I3657
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I2004
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54888
OrthoDB 1 1.010 - - D106508at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm6596
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43917
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.910

Return to query results.
Submit another query.