DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and Clic

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster


Alignment Length:159 Identity:36/159 - (22%)
Similarity:57/159 - (35%) Gaps:30/159 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSENVAIFRHLAREKLV 83
            ||:|.|...|..:...:.|.|.   ..:||.|...... |.:.|:|..:.||..|.||:.  |.:
  Fly    50 LYLLAELKTISLKVTTVDMQKP---PPDFRTNFEATHP-PILIDNGLAILENEKIERHIM--KNI 108

  Fly    84 PEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRPADNAVNLASKQLEHTLN 148
            |              ..|..:.|........|....|..:..::|....:||:      |.|...
  Fly   109 P--------------GGYNLFVQDKEVATLIENLYVKLKLMLVKKDEAKNNAL------LSHLRK 153

  Fly   149 EFEQLFLNSRKFMMGDNISYADLSAICEI 177
            ..:.|...:.:|:.||.:...|    ||:
  Fly   154 INDHLSARNTRFLTGDTMCCFD----CEL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 18/60 (30%)
GST_C_Theta 95..220 CDD:198292 16/83 (19%)
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 20/81 (25%)
O-ClC 21..231 CDD:129941 36/159 (23%)
GST_C_CLIC 118..232 CDD:198307 14/71 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459993
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.