DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GSTZ1

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001350632.1 Gene:GSTZ1 / 2954 HGNCID:4643 Length:217 Species:Homo sapiens


Alignment Length:181 Identity:38/181 - (20%)
Similarity:77/181 - (42%) Gaps:30/181 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YFDFLNQSSRALYILLEASKIPFEAIPISMLK--GEHLTGEFRDNVNRFRKLPAITDHGYQLSEN 70
            |..|.:..|..:.|.|....|.:|.:||:::|  |:..:.:|: .:|..:::|.:...|..:.::
Human    10 YSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQ-ALNPMKQVPTLKIDGITIHQS 73

  Fly    71 VAIFRHLAR----EKLVPEHWYPRRHLGRSRIDEYLA-----WQQTNMGVATTEYFQQKWLVPYL 126
            :||..:|..    .:|:|:.  |::......|.:.:|     .|..::.....|..|..|     
Human    74 LAIIEYLEEMRPTPRLLPQD--PKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTW----- 131

  Fly   127 QKTRPADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEI 177
                 |.||:......||..|.....:      :.:||.::.|||..:.::
Human   132 -----AQNAITCGFNALEQILQSTAGI------YCVGDEVTMADLCLVPQV 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 18/77 (23%)
GST_C_Theta 95..220 CDD:198292 17/88 (19%)
GSTZ1NP_001350632.1 maiA 8..212 CDD:273527 38/181 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.