DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and Eef1e1

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001099576.1 Gene:Eef1e1 / 291057 RGDID:1311056 Length:174 Species:Rattus norvegicus


Alignment Length:168 Identity:35/168 - (20%)
Similarity:65/168 - (38%) Gaps:50/168 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RKLPAI-TDHGYQLSENVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQ 118
            |::|.: |::|..|.....|..||.:|.       .:.||..|..:|              :...
  Rat    28 RQVPVLQTNNGPSLMGLSTIATHLVKEA-------NKEHLLGSTAEE--------------KALV 71

  Fly   119 QKWLVPYLQKTRPADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSI 183
            |:||  ..:.||...:    :||:...||.:....:|..:.::.|.|.:.||:...        .
  Rat    72 QQWL--EFRITRVDGH----SSKEDTQTLLKDLNSYLEDKVYLAGHNTTLADILLY--------Y 122

  Fly   184 GYNAF------QNRNK---LARWYETVREELGPHYKEV 212
            |.:.|      |.:.|   ::||:..::     ||.::
  Rat   123 GLHRFIVDLTVQEKEKYLNVSRWFCHIQ-----HYPDI 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 8/25 (32%)
GST_C_Theta 95..220 CDD:198292 24/127 (19%)
Eef1e1NP_001099576.1 GST_C_AIMP3 65..165 CDD:198338 23/124 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.