DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and gst2

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_588517.1 Gene:gst2 / 2539601 PomBaseID:SPCC965.07c Length:230 Species:Schizosaccharomyces pombe


Alignment Length:172 Identity:40/172 - (23%)
Similarity:73/172 - (42%) Gaps:39/172 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ILLEASKIPFEAIPISMLKG-----EHLTGEFRDNVNRFRKLPAITDH---GYQLSENVAIFRHL 77
            :.|:...:.:|.|.....||     |||.      :|...::|.:.||   .|.:.|:.||..:|
pombe    20 LALKELNLSYEQIFYDFQKGEQKCKEHLA------LNPNGRVPTLVDHKNNDYTIWESDAILIYL 78

  Fly    78 ARE-----KLV-----PEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRPA 132
            |.:     |:.     ||::         ::.:||.:|.:..||.   :.|..|...:..:  |.
pombe    79 ADKYDTDRKISLSFDDPEYY---------KLIQYLFFQASGQGVI---WGQAGWFNFFHHE--PV 129

  Fly   133 DNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAI 174
            .:||.....:::..|...|.: |..|.:::.:..:.||||.|
pombe   130 VSAVTRYRNEIKRVLGVLEDI-LKDRDYLVANKYTIADLSFI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 18/66 (27%)
GST_C_Theta 95..220 CDD:198292 19/80 (24%)
gst2NP_588517.1 GST_N_Ure2p_like 4..84 CDD:239346 18/69 (26%)
GstA 5..226 CDD:223698 40/172 (23%)
GST_C_Ure2p 96..219 CDD:198326 20/90 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.