DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and SPCC1183.02

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_587885.1 Gene:SPCC1183.02 / 2539015 PomBaseID:SPCC1183.02 Length:220 Species:Schizosaccharomyces pombe


Alignment Length:214 Identity:45/214 - (21%)
Similarity:73/214 - (34%) Gaps:68/214 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PLKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLS 68
            |.||..|.             |:|.|.:.:|:                       .|...|::||
pombe    36 PHKFSADL-------------AAKFPLQKLPV-----------------------FIGADGFELS 64

  Fly    69 ENVAIF-------RHLAREKLVPEHWYPRRHLGRSRIDEYLAWQ-QTNMGVATTEYFQQKWL--- 122
            |.:||.       :|..:|.|.|        :......|.|.|. ..|..:.|.:.. :.|:   
pombe    65 EVIAIVKYFYEKGKHNDKEGLGP--------VNEVEEAEMLKWMCFINFDIVTPQNV-RPWVGMF 120

  Fly   123 ---VPYLQKTRPADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADL--SAICEIDQPKS 182
               :||.:|  |...:...|...|: ..||    .:..|.:::||..:.|||  .::..|.....
pombe   121 RGNIPYEEK--PFKESATRAIDSLK-IPNE----LVKDRTYLVGDRFTLADLFFGSLLRIFFNSI 178

  Fly   183 IGYNAFQNRNKLARWYETV 201
            |.....:....|.|:|.|:
pombe   179 IDEKTRKELPHLTRYYITM 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 15/81 (19%)
GST_C_Theta 95..220 CDD:198292 26/116 (22%)
SPCC1183.02NP_587885.1 GST_N_EF1Bgamma 4..76 CDD:239342 15/75 (20%)
GstA 28..198 CDD:223698 45/214 (21%)
GST_C_EF1Bgamma_like 92..217 CDD:198290 26/114 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2071
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.