DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and gst1

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_588298.1 Gene:gst1 / 2538694 PomBaseID:SPCC191.09c Length:229 Species:Schizosaccharomyces pombe


Alignment Length:139 Identity:36/139 - (25%)
Similarity:63/139 - (45%) Gaps:18/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EHLTGEFRDNVNRFRKLPAITDH---GYQLSENVAIFRHLAREKLVPEH--WYPRRHLGRSRIDE 100
            |||.      :|...::|.:.||   .|.:.|:.||..:|| :|...|.  ..||.|....::.:
pombe    45 EHLA------LNPNGRVPTLIDHHNNDYTIWESDAILIYLA-DKYDTERKISLPRDHPEYYKVIQ 102

  Fly   101 YLAWQQTNMGVATTEYFQQKWLVPYLQKTRPADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDN 165
            ||.:|.:..|:.   :.|..|...|.|:.  ..:|:.....:::..|...|.: |..|.:::.:.
pombe   103 YLFFQASGQGII---WGQAGWFSVYHQEL--VISAITRYRNEIKRVLGVLEDI-LKDRDYLVANR 161

  Fly   166 ISYADLSAI 174
            .:.||||.|
pombe   162 FTIADLSFI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 13/41 (32%)
GST_C_Theta 95..220 CDD:198292 18/80 (23%)
gst1NP_588298.1 GST_N_Ure2p_like 3..84 CDD:239346 14/45 (31%)
GstA 5..218 CDD:223698 36/139 (26%)
GST_C_Ure2p 96..219 CDD:198326 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.