DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment GstT4 and Vars1

DIOPT Version :9

Sequence 1:	NP_572886.2	Gene:	GstT4 / 32299	FlyBaseID:	FBgn0030484	Length:	237	Species:	Drosophila melanogaster
Sequence 2:	NP_445744.1	Gene:	Vars1 / 25009	RGDID:	3950	Length:	1264	Species:	Rattus norvegicus

Alignment Length:	90	Identity:	27/90 - (30%)
Similarity:	42/90 - (46%)	Gaps:	8/90 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   143 LEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNR--NKLARWYET-VREE 204
            |...||..|: :|....::.||..:.|||:|:..:..|.....:....|  ..:.||:.| ||:
  Rat   135 LGKALNPLEE-WLRLHTYLAGDAPTLADLAAVTALLLPFRYVLDPSARRIWGNVTRWFNTCVRQ- 197

  Fly   205 LGPHYKEVLGEFEAKLKGSGSGQQQ 229
              |.::.||||. ....|:.|..||
  Rat   198 --PEFRAVLGEV-VLYSGARSVTQQ 219

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
GstT4	NP_572886.2	GST_N_Theta	5..80	CDD:239348
GstT4	NP_572886.2	GST_C_Theta	95..220	CDD:198292	23/79 (29%)
Vars1	NP_445744.1	GstA	<56..203	CDD:223698	19/71 (27%)
		GST_C_family	92..213	CDD:295467	23/82 (28%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	218..296		2/2 (100%)
		PTZ00419	282..1264	CDD:240411
		ValRS_core	335..938	CDD:185677
		'HIGH' region	344..354
		tRNA-synt_1_2	513..640	CDD:290334
		'KMSKS' region	862..866
		Anticodon_Ia_Val	938..1075	CDD:153416
		Val_tRNA-synt_C	1196..1258	CDD:287436
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0625
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900