DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GstE9

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:219 Identity:51/219 - (23%)
Similarity:97/219 - (44%) Gaps:32/219 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSENVAIFRHLAREK 81
            ||..:.|:|..:.:|...:::|.|||.|.|| ...|....:|.:.|.|..:.|:.||..:|.|..
  Fly    16 RACKLTLDALGLQYEYRLVNLLAGEHKTKEF-SLKNPQHTVPVLEDDGKFIWESHAICAYLVRRY 79

  Fly    82 LVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQ---QKWLVPYLQKTRPADNAVNLASKQL 143
            ...:..||:.:..|:.:|:.|.::.   ||    .||   :...:|...|     |...:...|:
  Fly    80 AKSDDLYPKDYFKRALVDQRLHFES---GV----LFQGCIRNIAIPLFYK-----NITEVPRSQI 132

  Fly   144 E--HTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNRN--KLARWYETVREE 204
            :  :...:|.:.|:.::.::.|..|:.||.|.:..:.  ..:|..|...:.  ||..|.:.:..:
  Fly   133 DAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVS--SLVGLAAIDAKRYPKLNGWLDRMAAQ 195

  Fly   205 LGPHYKEVLGE--------FEAKL 220
              |:|:.:.|.        |.:|:
  Fly   196 --PNYQSLNGNGAQMLIDMFSSKI 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 20/62 (32%)
GST_C_Theta 95..220 CDD:198292 27/139 (19%)
GstE9NP_725784.1 GstA 4..201 CDD:223698 48/201 (24%)
GST_N_Delta_Epsilon 4..76 CDD:239343 19/60 (32%)
GST_C_Delta_Epsilon 92..209 CDD:198287 26/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459984
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.