DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and GstT2

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster


Alignment Length:225 Identity:79/225 - (35%)
Similarity:128/225 - (56%) Gaps:4/225 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQPLKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGY 65
            ||:|::||:|.|:..:|.|:|.|:.|..|.|..||::.|.|.||.|:: .:|||:|:|||....:
  Fly     1 MSKPIRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYK-KINRFQKVPAIVGGDF 64

  Fly    66 QLSENVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQ-KT 129
            .|||.:||.|:||.:....|..||:....|:|:||:|.||..|:.:|.:.||:..||.|... ..
  Fly    65 HLSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAP 129

  Fly   130 RPADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNR-NK 193
            :|....:....:.:|:.|...|:|:|.: .|::|.|::.||:....||:|.:...|...:.: .|
  Fly   130 KPKPEQIQALIEGVENNLGLLERLWLEN-DFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPK 193

  Fly   194 LARWYETVREELGPHYKEVLGEFEAKLKGS 223
            :.:|.|.||....|::.|.|...:.|.|.|
  Fly   194 VVKWLERVRVSANPYHDEGLTFIDRKSKQS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 33/74 (45%)
GST_C_Theta 95..220 CDD:198292 37/126 (29%)
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 33/75 (44%)
GstA 7..202 CDD:223698 68/196 (35%)
GST_C_family 93..218 CDD:295467 37/125 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459964
Domainoid 1 1.000 64 1.000 Domainoid score I3657
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I2004
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54888
OrthoDB 1 1.010 - - D106508at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm1047
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43917
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.910

Return to query results.
Submit another query.