DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and Gstp3

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_030106733.1 Gene:Gstp3 / 225884 MGIID:2385078 Length:260 Species:Mus musculus


Alignment Length:185 Identity:40/185 - (21%)
Similarity:59/185 - (31%) Gaps:76/185 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 FRKLPAITDHGYQLSENVAIFRHLARE-----------KLVP------EHWYPR-----RHLGRS 96
            |.::|...|....|.::..|.|||.|.           .||.      |..:.|     ||:.:.
Mouse   100 FGQIPKFQDGELTLYQSNTILRHLGRS
FGLYGKDQQEAALVDMVNDGLEDLFRRIARQYRHILKE 164

  Fly    97 RIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRPADNAVNLASKQLEHTLNEFEQLFLNSR--- 158
            ..|:|                                      .|:|...|..||.|...:|   
Mouse   165 GKDQY--------------------------------------QKELPGHLKPFETLLAQNRGGQ 191

  Fly   159 KFMMGDNISYAD---LSAICEI---------DQPKSIGYNA-FQNRNKLARWYET 200
            .|::||.||:||   |..:..:         |.|....|.| .::|.||..:.|:
Mouse   192 SFIVGDQISFADYRLLDVLLNLELLFPGYLNDFPLFSAYVARLKSRPKLKAFLES 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 8/25 (32%)
GST_C_Theta 95..220 CDD:198292 25/122 (20%)
Gstp3XP_030106733.1 Thioredoxin_like 63..126 CDD:381987 8/25 (32%)
GST_C_family 134..253 CDD:383119 31/151 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.