DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and eef1g

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_775370.1 Gene:eef1g / 195822 ZFINID:ZDB-GENE-020423-3 Length:442 Species:Danio rerio


Alignment Length:210 Identity:52/210 - (24%)
Similarity:86/210 - (40%) Gaps:45/210 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KLPAIT-DHGYQLSENVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYF-- 117
            |:||.. |.|:.|.|:.||..:|:.:.|        |........:.|.|    :..|.:|..  
Zfish    57 KVPAYQGDDGFCLFESNAIAHYLSNDVL--------RGSTPQASAQVLQW----VSFADSEVIPP 109

  Fly   118 QQKWLVPYLQKTRPADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEI----D 178
            ...|:.|.|...:....|...|.::::..|....| .||:|.|::|:.||.||::.:|.:    .
Zfish   110 ASAWVFPTLGIMQFNKQATEQAKEEVKRVLAVLNQ-HLNTRTFLVGERISLADITVVCSLLWLYK 173

  Fly   179 QPKSIGYNAFQNRNKLARWYETVREELGPHYKEVLGE---------FEAK------------LKG 222
            |...:.:.  |....:.||:.|...:  |.:|.||||         |:||            :|.
Zfish   174 QVLELAFR--QPYPNVTRWFVTCVNQ--PQFKTVLGEVKLCEKMAQFDAKKFAEMQPKKEAPIKK 234

  Fly   223 SGSGQQQGVAQAVKQ 237
            ...|::.|..|..:|
Zfish   235 EKGGKEGGKQQPQQQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 10/24 (42%)
GST_C_Theta 95..220 CDD:198292 35/151 (23%)
eef1gNP_775370.1 GST_N_EF1Bgamma 4..82 CDD:239342 10/24 (42%)
maiA 5..201 CDD:273527 39/160 (24%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 32/130 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..273 5/23 (22%)
EF1G 280..386 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.