DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and gst-43

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_491070.1 Gene:gst-43 / 190586 WormBaseID:WBGene00001791 Length:214 Species:Caenorhabditis elegans


Alignment Length:228 Identity:53/228 - (23%)
Similarity:98/228 - (42%) Gaps:35/228 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQPLKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHL-TGEFRDNVNRFRKLPAITDHG 64
            |::|: .|..:.:..:..:.|.|....|.:|..||.:...|.. ..||..: |..:|:|.:..:|
 Worm     1 MAKPI-LYSYWRSSCAWRVRIALALKNIDYEYRPIDLFSEESKNNAEFVKH-NPAKKVPTLVING 63

  Fly    65 YQLSENVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKT 129
            ..|:|::||..:|  ::..|:..:..:.|.:......:|...    ||:.:..|...:...|.:.
 Worm    64 LSLTESLAIIEYL--DEAYPDPPFLPKELDKRSYSRAIALHI----VASIQPLQAINIHKMLNEK 122

  Fly   130 RP------ADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAF 188
            .|      .::.||.....||..|.:      :|.|:.:||.::.||::.       .||.|||.
 Worm   123 EPGYGDFWCNHFVNKGFLALEELLKK------HSGKYCVGDQLTIADINL-------PSIIYNAK 174

  Fly   189 QNRNKLARWYETVREELGPHYKEVLGE-FEAKL 220
            ..:..::: |.|:     ....|:|.| |..||
 Worm   175 IYKVDMSK-YPTI-----TRINEILAEDFRFKL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 19/75 (25%)
GST_C_Theta 95..220 CDD:198292 28/131 (21%)
gst-43NP_491070.1 GST_N_Zeta 4..77 CDD:239340 20/76 (26%)
maiA 5..211 CDD:273527 51/224 (23%)
GST_C_Zeta 90..207 CDD:198300 31/135 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163398
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.