Sequence 1: | NP_572886.2 | Gene: | GstT4 / 32299 | FlyBaseID: | FBgn0030484 | Length: | 237 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_503532.1 | Gene: | gst-37 / 189575 | WormBaseID: | WBGene00001785 | Length: | 209 | Species: | Caenorhabditis elegans |
Alignment Length: | 205 | Identity: | 40/205 - (19%) |
---|---|---|---|
Similarity: | 78/205 - (38%) | Gaps: | 60/205 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 YFDF--LNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSEN 70
Fly 71 VAIFRHLAREKLVPEHWYPRRHLG-RSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRPADN 134
Fly 135 AVNLASKQLEHTLNEFEQLFLNSRK----------------FMMGDNISYADLSAICEI------ 177
Fly 178 ------DQPK 181 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstT4 | NP_572886.2 | GST_N_Theta | 5..80 | CDD:239348 | 20/73 (27%) |
GST_C_Theta | 95..220 | CDD:198292 | 19/115 (17%) | ||
gst-37 | NP_503532.1 | GST_N_Sigma_like | 4..74 | CDD:239337 | 19/71 (27%) |
PTZ00057 | 6..209 | CDD:173353 | 40/205 (20%) | ||
GST_C_Sigma_like | 85..191 | CDD:198301 | 19/110 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |