DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and gst-42

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_509962.1 Gene:gst-42 / 183911 WormBaseID:WBGene00001790 Length:214 Species:Caenorhabditis elegans


Alignment Length:170 Identity:34/170 - (20%)
Similarity:67/170 - (39%) Gaps:44/170 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSENVAIFRHLARE----K 81
            |.|....:.:|...:.:| .|....:.:: :|...|:|.....|..::|::||..:|...    .
 Worm    22 IALALKNVDYEYKTVDLL-SEEAKSKLKE-INPAAKVPTFVVDGQVITESLAIIEYLEETHPDVP 84

  Fly    82 LVPEHWYPRRH--------------LGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRPA 132
            |:|:....|.|              |...::.:.|..::...|    ..|.::::|..|      
 Worm    85 LLPKDPIKRAHARAISLLVASGIQPLHNLKVLQLLNKKEAGFG----GQFAKQFVVEGL------ 139

  Fly   133 DNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLS 172
             .|:.:..||             :|.|:.:||:::.||||
 Worm   140 -TALEILLKQ-------------HSGKYAVGDDVTIADLS 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 13/58 (22%)
GST_C_Theta 95..220 CDD:198292 16/78 (21%)
gst-42NP_509962.1 GST_N_Zeta 6..77 CDD:239340 12/56 (21%)
maiA 7..211 CDD:273527 34/170 (20%)
GST_C_Zeta 90..207 CDD:198300 19/100 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.