DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and gst-27

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_497116.1 Gene:gst-27 / 175166 WormBaseID:WBGene00001775 Length:209 Species:Caenorhabditis elegans


Alignment Length:209 Identity:42/209 - (20%)
Similarity:76/209 - (36%) Gaps:56/209 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ILLEASKIPFEAIPISMLKG--EHLTGEFRDNVNRFRKLPAITDHGYQLSENVAIFRHLAREKLV 83
            ||...:.:|||...:::..|  |:|..:     ..|.:.|.::..|:::.::.||.|:||::   
 Worm    20 ILFHLADVPFEDFRMTIGDGTWENLKAK-----TPFGQAPVLSVDGFEIPQSAAINRYLAKQ--- 76

  Fly    84 PEHWYPRRHLG-RSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRPADNAVNLASKQLEHTL 147
                     .| ..:..|..||..    ....:|......:..:.|...|..:.....|.::..|
 Worm    77 ---------FGYAGKTPEEQAWTD----AIVDQYKDFMVSIKEVGKASAAGKSAEEVGKIIQSDL 128

  Fly   148 NEFEQLF-------LNSRK--FMMGDNISYADL---SAICEID---------QPKSIGYNAFQNR 191
            ......|       |...|  |::||.::.||:   ..|..:|         |||.:..     |
 Worm   129 VPARDAFFVIINKILEKSKSGFLVGDGLTIADIVIVECITTLDKHQLFTASEQPKLVAL-----R 188

  Fly   192 NK------LARWYE 199
            .|      :.:|.|
 Worm   189 EKVYAIPAIKKWVE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 16/60 (27%)
GST_C_Theta 95..220 CDD:198292 25/132 (19%)
gst-27NP_497116.1 GST_N_Sigma_like 4..75 CDD:239337 15/59 (25%)
PTZ00057 6..208 CDD:173353 42/209 (20%)
GST_C_Sigma_like 85..191 CDD:198301 22/114 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.