DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and LOC1270342

DIOPT Version :10

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_309027.3 Gene:LOC1270342 / 1270342 VectorBaseID:AGAMI1_014353 Length:407 Species:Anopheles gambiae


Alignment Length:58 Identity:18/58 - (31%)
Similarity:28/58 - (48%) Gaps:5/58 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RALYILLEASKI-PFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSENVAI 73
            |:|:.||...:: ...|..:..|:.:..|    ..::.||||...|:.||.|...|||
Mosquito    18 RSLFRLLTVGQVFGLVAWDLEPLEPDRPT----TKLHWFRKLIRTTNQGYCLMIIVAI 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 18/58 (31%)
GST_C_Theta 95..220 CDD:198292
LOC1270342XP_309027.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.