DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and LOC100911464

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_038967329.1 Gene:LOC100911464 / 100911464 RGDID:6492721 Length:249 Species:Rattus norvegicus


Alignment Length:176 Identity:40/176 - (22%)
Similarity:70/176 - (39%) Gaps:44/176 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ALYILLEASKIPFEAI--PISMLKGEHLTGEFRDNVNR----------FRKLPAITDHGYQLSEN 70
            ||:.|||.:.|..:.:  .:::.|     |.||..|.:          :.:||...|....|.::
  Rat    56 ALWKLLETAGIISQDVETTVALFK-----GLFRFEVVQGWSGKLHTCLYGQLPKFEDGDLTLYQS 115

  Fly    71 VAIFRHLAREKLVPEHWYPRRH----LGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRP 131
            .||.||:.             |    .|:.:.:..|. ...|.||....| :...|:..:.    
  Rat   116 SAILRHVG-------------HSFGLYGKGQREAALV-DMVNDGVEDLHY-RYVTLIYTIY---- 161

  Fly   132 ADNAVNLASKQLEHTLNEFEQLFLNSRK---FMMGDNISYADLSAI 174
             :|..:...|.|...|..||.|...:::   |::||.||:|:.:.:
  Rat   162 -ENGKDDYMKALPGHLKPFETLLSQNQEGKAFIVGDQISFANYNLL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 19/73 (26%)
GST_C_Theta 95..220 CDD:198292 19/83 (23%)
LOC100911464XP_038967329.1 Thioredoxin_like <96..123 CDD:412351 8/26 (31%)
GST_C_family 133..249 CDD:413470 19/81 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.