DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT4 and gstz1

DIOPT Version :9

Sequence 1:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_002938913.1 Gene:gstz1 / 100145591 XenbaseID:XB-GENE-978910 Length:216 Species:Xenopus tropicalis


Alignment Length:214 Identity:47/214 - (21%)
Similarity:89/214 - (41%) Gaps:42/214 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQPLKFYFDFLNQSSRALYILLEASKIPFEAIPISMLK--GEHLTGEFRDNVNRFRKLPAITDH 63
            :.:|| .|..|.:..|..:.|.|....|.::...|:::|  |..|:.|:: .||..:::||:...
 Frog     4 LGKPL-LYGYFRSSCSWRVRIALAFKGIEYDQQVINLVKDGGMQLSNEYK-QVNPMQQVPALCID 66

  Fly    64 GYQLSENVAIFRHLAREK----LVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVP 124
            |..||:::||..:|...:    |:|..  |::......|.:.:|     .|:      |....:.
 Frog    67 GVTLSQSLAIIEYLEETRPNPPLLPRD--PKKRAQVRMISDQIA-----SGI------QPLQNLC 118

  Fly   125 YLQKTRPADNAVNLASKQLEHTLNEFEQLF-LNSRKFMMGDNISYADLSAICEI----------- 177
            .|||.  .:..:..|...:.......|:|. ..:.::.:||.::.|||..:.::           
 Frog   119 VLQKI--GETKLEWAKHFITRGFQALEKLLQTTAGRYCVGDEVTIADLCLVPQVANAVRFKVDLA 181

  Fly   178 DQPKSIGYN-------AFQ 189
            ..|..:|.|       |||
 Frog   182 PYPTIVGINESLLQLEAFQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 22/76 (29%)
GST_C_Theta 95..220 CDD:198292 21/114 (18%)
gstz1XP_002938913.1 maiA 8..211 CDD:273527 46/210 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.