DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12725 and CG32713

DIOPT Version :10

Sequence 1:NP_572885.1 Gene:CG12725 / 32298 FlyBaseID:FBgn0030483 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_727264.1 Gene:CG32713 / 318166 FlyBaseID:FBgn0052713 Length:184 Species:Drosophila melanogaster


Alignment Length:184 Identity:114/184 - (61%)
Similarity:126/184 - (68%) Gaps:28/184 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRKMQVLVQTSDGKKTVYDVDRFGTVANLKARIGRAMSVPMGFSRLSYKGRELSNQSILEDVG-H 64
            |||:||||||.|||||||:|||.||||:||||||:.|||||||||||||||.|||||:|||:| :
  Fly     1 MRKVQVLVQTRDGKKTVYEVDRLGTVASLKARIGQVMSVPMGFSRLSYKGRVLSNQSVLEDLGPN 65

  Fly    65 KSILDLTWKPVVLTPKQLREKKIGKFSKFGYGRKNDSGEHMSTLIGGYQQR----------IDLE 119
            ||.|||||||||||..|     ..|.|||||||.:|| |.|.|||||||||          .|.|
  Fly    66 KSTLDLTWKPVVLTANQ-----SSKLSKFGYGRIDDS-EVMFTLIGGYQQREEYPGGLVNPPDDE 124

  Fly   120 S--------DDDELEAQDLTELDLLSLNSDDSLVNNQTELE---PIAPLNFSGS 162
            |        |||.|||||:|..||.|:.:||..:..|||.|   .|....||||
  Fly   125 SQLNFNAGDDDDALEAQDMTGHDLSSIQTDDLSLKGQTEPELDCSIGSHGFSGS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12725NP_572885.1 Ubl_ubiquitin_like 6..70 CDD:340559 52/64 (81%)
CG32713NP_727264.1 Ubl_ubiquitin_like 6..71 CDD:340559 52/64 (81%)

Return to query results.
Submit another query.