DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12725 and AT1G53950

DIOPT Version :10

Sequence 1:NP_572885.1 Gene:CG12725 / 32298 FlyBaseID:FBgn0030483 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001319219.1 Gene:AT1G53950 / 28717351 AraportID:AT1G53950 Length:144 Species:Arabidopsis thaliana


Alignment Length:70 Identity:20/70 - (28%)
Similarity:36/70 - (51%) Gaps:2/70 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MQVLVQTSDGKKTVYDVDRFGTVANLKARIGRAMSVPMGFSRLSYKGRELSNQSILED--VGHKS 66
            |.:.::|..|:...|:|....|:..|||:......:|:...||.::||.|.:...:.|  :.|:|
plant    69 MMIFIKTLTGRTNTYEVKGSDTIRELKAKHEEKEGIPVEQQRLIFQGRVLEDSKAISDYNIKHES 133

  Fly    67 ILDLT 71
            .|.:|
plant   134 TLHIT 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12725NP_572885.1 Ubl_ubiquitin_like 6..70 CDD:340559 18/65 (28%)
AT1G53950NP_001319219.1 Ubl1_cv_Nsp3_N-like 69..139 CDD:475130 20/70 (29%)

Return to query results.
Submit another query.