DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1673 and ABZ2

DIOPT Version :9

Sequence 1:NP_572884.1 Gene:CG1673 / 32297 FlyBaseID:FBgn0030482 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_014016.1 Gene:ABZ2 / 855333 SGDID:S000004902 Length:374 Species:Saccharomyces cerevisiae


Alignment Length:312 Identity:67/312 - (21%)
Similarity:113/312 - (36%) Gaps:75/312 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 DHMLKIYYHKSL---GGWQRPEI----------TPLENLVMHPAAKVL-HYAVELFEGMKAYRGV 161
            :.||::.|.:..   ..:||..|          |.|.:|:     |:| ...:...||...|.  
Yeast   109 EDMLQVIYERFFLLDEQYQRIRIALSYFKIDFSTSLNDLL-----KLLVENLINCKEGNSEYH-- 166

  Fly   162 DGKIRIFRPDMNMNRMNLAAQRSGLPTFEGKEFVQCLSRLLSIDSEWVPHTDTASLYIRPTLIG- 225
             .||:....:....:|.:...::|....|.  ....:..:|.:.:::    |:.|.|...|::. 
Yeast   167 -EKIQKMINERQCYKMRVLVSKTGDIRIEA--IPMPMEPILKLTTDY----DSVSTYFIKTMLNG 224

  Fly   226 --IDPTLG---VASSD--SALLYTILSPVGSYFKTGSSGAVSLLADPSYVRA---WPGGVGNRKM 280
              ||.|:.   |.||:  :|..:|       .|||.|.        ..|.||   ....:.|.: 
Yeast   225 FLIDSTINWDVVVSSEPLNASAFT-------SFKTTSR--------DHYARARVRMQTAINNLR- 273

  Fly   281 GSNYAPTINVQKEAAAKGLQQVLWLYGEDHQLTEVGTMNIFMFFVNDQGEQELVTPPLSGLILPG 345
            ||.  ||.:|.        |..:....:...|.|....|:.:...:..|.::.|||.|:...|.|
Yeast   274 GSE--PTSSVS--------QCEILFSNKSGLLMEGSITNVAVIQKDPNGSKKYVTPRLATGCLCG 328

  Fly   346 ITRDSILRMTRQWGKFKVSEANITMPMVCELLNQGRLLELFGAGTACVVSPV 397
            ..|..:||:.      .:.|.:|.:..    |..|..:.||.....|:...|
Yeast   329 TMRHYLLRLG------LIEEGDIDIGS----LTVGNEVLLFNGVMGCIKGTV 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1673NP_572884.1 PRK13357 82..443 CDD:237363 67/312 (21%)
BCAT_beta_family 138..432 CDD:238798 58/272 (21%)
ABZ2NP_014016.1 IlvE 38..366 CDD:223193 65/306 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0115
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.