DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1673 and ADCL

DIOPT Version :9

Sequence 1:NP_572884.1 Gene:CG1673 / 32297 FlyBaseID:FBgn0030482 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_200593.2 Gene:ADCL / 835895 AraportID:AT5G57850 Length:373 Species:Arabidopsis thaliana


Alignment Length:441 Identity:84/441 - (19%)
Similarity:152/441 - (34%) Gaps:136/441 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FRNQHRLIRFLEQSIRLCSNQSLKAAQAAQLQQKSSADFEITASLDAQYTSAPEPIKHDKNLGHQ 77
            ||...||.|  .::|.:||:.|.::.....|     :.:|:           .|.:|..:. |.|
plant    29 FRFPRRLTR--RRTILMCSDSSSQSWNVPVL-----SSYEV-----------GERLKLARG-GQQ 74

  Fly    78 FRASQISVRLAAPEQLQPKPDNDEELGFGRLFTDHMLKIYYHKSLGGWQRPEITPLENLVMHPAA 142
            |.|...||                                               ::.:...|||
plant    75 FLAMYSSV-----------------------------------------------VDGITTDPAA 92

  Fly   143 KVL-------HYAVELFEGMKAYRGVDGKIRIFRPDMNMNRMNLAAQRSGLP-TFEGKEFVQCLS 199
            .||       |....:|:......|.     ::..|.:::|:..:|..:.:| .|:.:...:.|.
plant    93 MVLPLDDHMVHRGHGVFDTALIINGY-----LYELDQHLDRILRSASMAKIPLPFDRETIKRILI 152

  Fly   200 RLLSIDS-------EWVPHTD-----TASLYIRPTLIGIDPTLGVASSDSALLYTILSPVGSYFK 252
            :.:|:..       .|:....     :.|..::|||..|     |..::.|     ::|:|....
plant   153 QTVSVSGCRDGSLRYWLSAGPGDFLLSPSQCLKPTLYAI-----VIKTNFA-----INPIGVKVV 207

  Fly   253 TGSSGAVSLLADPSYVRAWPGGVGNRKMGSNYAPTINVQKEAAAKGLQQVLWLYGEDHQLTEVGT 317
            |.|..    :..|.:...         ...||.|.:..|.||.|||....:|:. :|..:.|...
plant   208 TSSIP----IKPPEFATV---------KSVNYLPNVLSQMEAEAKGAYAGIWVC-KDGFIAEGPN 258

  Fly   318 MNIFMFFVNDQGEQELVTPPLSGLILPGITRDSILRMTRQWGKFKVSEANITMPMVCELLNQGRL 382
            ||: .|.||  |.:|||.|.... :|.|.|....|.:..|.....:.:....|.:..|...:...
plant   259 MNV-AFVVN--GGKELVMPRFDN-VLSGCTAKRTLTLAEQLVSKGILKTVKVMDVTVEDGKKADE 319

  Fly   383 LELFGAGTACVVSPVNRI-----SYLGQDLYIPTMEQEKPVHELIRETLTD 428
            :.|.|:|.     |:..:     .::|:.       :|.|:.:.:.:.|.:
plant   320 MMLIGSGI-----PIRPVIQWDEEFIGEG-------KEGPIAKALLDLLLE 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1673NP_572884.1 PRK13357 82..443 CDD:237363 67/372 (18%)
BCAT_beta_family 138..432 CDD:238798 65/316 (21%)
ADCLNP_200593.2 PLN02845 43..373 CDD:215454 78/425 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0115
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D853728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.