DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and Mpv17l

DIOPT Version :10

Sequence 1:NP_572883.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_291042.2 Gene:Mpv17l / 93734 MGIID:2135951 Length:194 Species:Mus musculus


Alignment Length:143 Identity:45/143 - (31%)
Similarity:77/143 - (53%) Gaps:6/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 TNVGISLTLSCVGDVLEQHLEIYCGEIERFESTRTAHMAISGVTVGVICHYWYKMLDKRMPGRTM 142
            |||.:...|...||.|:|.|.  .|..:..::.|.|.:|::  ..|...:.|.::|::.:|||..
Mouse    19 TNVLLYAGLFSAGDALQQRLR--GGPADWRQTRRVATLAVT--FHGNFNYVWLRLLERALPGRAP 79

  Fly   143 RVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAEWTVWPVAQFVNFY 207
            |.|..|::.||.:..||.:|||:|.:.:|:  .|.:::.::|:|.|..|.:....||..|..||.
Mouse    80 RTVLAKVLCDQTVGGPIALSAFYVGMSVLQ--GKDDIFLDLKQKFWNTYKSGLMYWPFVQLTNFS 142

  Fly   208 WIPTHYRIFYDNI 220
            .:|.|:|..|..:
Mouse   143 LVPVHWRTAYTGL 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_572883.1 Mpv17_PMP22 169..230 CDD:461182 15/52 (29%)
Mpv17lNP_291042.2 Targeting to peroxisomes 16..55 12/37 (32%)
Mpv17_PMP22 106..165 CDD:461182 15/52 (29%)

Return to query results.
Submit another query.