DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and YOR292C

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_014935.3 Gene:YOR292C / 854467 SGDID:S000005818 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:106 Identity:27/106 - (25%)
Similarity:54/106 - (50%) Gaps:6/106 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 WYKMLD---KRMPGRTMRVVAKKIVLDQLICSPIYISAFFVTLG-LLEQKTKHEVWEEIKEKAWK 189
            |||.|:   ...|  |:..|.::::.|||:.|||.:..||:... ::|...|..:.::|:.....
Yeast   200 WYKFLNFFYTEDP--TVVQVFERVLSDQLLYSPISLYCFFMFSNYVMEGGDKDTLGKKIQRLYIS 262

  Fly   190 LYAAEWTVWPVAQFVNFYWIPTHYRIFYDNIISLGYDVLTS 230
            .....:.|||:.||:||..:|..::..:.:.:.:.::...|
Yeast   263 TLGCNYLVWPMVQFINFLIMPRDFQAPFSSSVGVVWNCFLS 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 12/61 (20%)
YOR292CNP_014935.3 Mpv17_PMP22 243..303 CDD:397992 11/59 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2546
TreeFam 1 0.960 - -
54.670

Return to query results.
Submit another query.