DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and SYM1

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_013352.1 Gene:SYM1 / 850953 SGDID:S000004241 Length:197 Species:Saccharomyces cerevisiae


Alignment Length:178 Identity:45/178 - (25%)
Similarity:83/178 - (46%) Gaps:16/178 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 TNVGISLTLSCVGDVLEQHLEIYCGEIERFESTRTAHMAISGVTV-GVICHYWYKMLDKRM---- 137
            ||..::..|..:|||..|.|.......:.::..|||...|.|..: ..|...|||:|:.::    
Yeast    18 TNAIMTGALFGIGDVSAQLLFPTSKVNKGYDYKRTARAVIYGSLIFSFIGDKWYKILNNKIYMRN 82

  Fly   138 -PGRTMRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAEWTVWPVA 201
             |......:..::.:|||..:|:.:..:|..:.::|.::......:|||:.|......|.|||:.
Yeast    83 RPQYHWSNMVLRVAVDQLAFAPLGLPFYFTCMSIMEGRSFDVAKLKIKEQWWPTLLTNWAVWPLF 147

  Fly   202 QFVNFYWIPTHYRIFYDNIISLGYDVL----TSKVKHKQSHSHLKKIP 245
            |.:||..:|..:|:...|::::.::..    .|||..|.      |:|
Yeast   148 QAINFSVVPLQHRLLAVNVVAIFWNTYLSYKNSKVMEKD------KVP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 18/67 (27%)
SYM1NP_013352.1 Mpv17_PMP22 115..176 CDD:397992 15/60 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.700

Return to query results.
Submit another query.