DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and MPV17L2

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_116072.2 Gene:MPV17L2 / 84769 HGNCID:28177 Length:206 Species:Homo sapiens


Alignment Length:189 Identity:71/189 - (37%)
Similarity:105/189 - (55%) Gaps:13/189 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GFGALQKLREWHASAFSSRFLLFTNVGISLTLSC-----VGDVLEQHLEIYCGEIERFESTRTAH 114
            |:..|::|.......|..|.||.||     ||.|     .||.:.|..||.....:.|:..|:|.
Human     5 GWRRLRRLLSAGQLLFQGRALLVTN-----TLGCGALMAAGDGVRQSWEIRARPGQVFDPRRSAS 64

  Fly   115 MAISGVTVGVICHYWYKMLDKRMPGRTMR---VVAKKIVLDQLICSPIYISAFFVTLGLLEQKTK 176
            |...|.::|...||||..||:..|...:|   .|.||:::|||:.||:....:|:.||.||.:|.
Human    65 MFAVGCSMGPFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLGLGCLEGQTV 129

  Fly   177 HEVWEEIKEKAWKLYAAEWTVWPVAQFVNFYWIPTHYRIFYDNIISLGYDVLTSKVKHK 235
            .|..:|::||.|:.|.|:|.|||.||||||.::|..:|:.|.|.::||:|...|.:|::
Human   130 GESCQELREKFWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYLKYR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 28/63 (44%)
MPV17L2NP_116072.2 Mpv17_PMP22 122..183 CDD:397992 28/60 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147002
Domainoid 1 1.000 69 1.000 Domainoid score I9646
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13093
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 1 1.000 - - FOG0003674
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 1 1.100 - - LDO PTHR11266
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 1 1.000 - - X2546
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.