DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and AT5G19750

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_197476.1 Gene:AT5G19750 / 832095 AraportID:AT5G19750 Length:288 Species:Arabidopsis thaliana


Alignment Length:234 Identity:60/234 - (25%)
Similarity:108/234 - (46%) Gaps:27/234 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RMSWP------------------RNSSATGGAGGAAPGGGSS---TTTSTIGFGALQKLREWHAS 68
            |.:||                  .||..:||.||:..|||.|   ....:.|.|....|..|:.:
plant    56 RSNWPGRSGTAFGHLVRVSAVPGGNSGGSGGLGGSGGGGGGSGGGGGDGSDGKGKKWSLLSWYQA 120

  Fly    69 AFSSRFLLFTNVGISLTLSCVGDVLEQHLEIYCGEIERFESTRTAHMAISGV-TVGVICHYWYKM 132
            ..|:..:|...|..:| |:.|||::   .::...:....:..||......|: .||...|:||..
plant   121 LLSNSPVLTKAVTAAL-LNLVGDLI---CQLTINKTSSLDKKRTLTFTFLGLGLVGPTLHFWYLY 181

  Fly   133 LDKRMPGRTMRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAEWTV 197
            |.|.:....:.....:::|||.:.:||::..|...:..||.|..: |..:::::......|.|.:
plant   182 LSKVVTASGLSGAVIRLLLDQFVFAPIFVGVFLSAVVTLEGKPSN-VIPKLQQEWTGAMIANWQL 245

  Fly   198 WPVAQFVNFYWIPTHYRIFYDNIISLGYDVLTSKVKHKQ 236
            |...||:||.::|.:|::...|:::|.::|:.|...||:
plant   246 WIPFQFLNFRFVPQNYQVLASNVVALAWNVILSFKAHKE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 17/63 (27%)
AT5G19750NP_197476.1 LbR-like <21..>69 CDD:248061 3/12 (25%)
Mpv17_PMP22 220..278 CDD:367825 16/58 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.