DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and PMP22

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001319865.1 Gene:PMP22 / 825777 AraportID:AT4G04470 Length:190 Species:Arabidopsis thaliana


Alignment Length:155 Identity:43/155 - (27%)
Similarity:82/155 - (52%) Gaps:14/155 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LSCVGDVLEQHLEIYCGEIERFESTRTAHMAI-SGVTVGVICHYWYKMLDKRMPG-RTMRVVAKK 148
            ||.|.||:.|.|    ..|::.:..|.....| :|..:|...|:::..|||...| :..:.||||
plant    33 LSGVSDVVSQKL----SGIQKIQLRRVLLKVIFAGGFLGPAGHFFHTYLDKFFKGKKDTQTVAKK 93

  Fly   149 IVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLY----AAEWTVWPVAQFVNFYWI 209
            ::|:||..||:....|.:..|::.::|.   |..::|:..|.|    ...||.:||..::|:.::
plant    94 VILEQLTLSPLNHLLFMIYYGVVIERTP---WTLVRERIKKTYPTVQLTAWTFFPVVGWINYKYV 155

  Fly   210 PTHYRIFYDNIISLGYDV-LTSKVK 233
            |.|:|:...::::..:.: ||.:.:
plant   156 PLHFRVILHSLVAFFWGIFLTLRAR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 15/69 (22%)
PMP22NP_001319865.1 Mpv17_PMP22 116..175 CDD:397992 13/61 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.