DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and AT3G24570

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_189100.1 Gene:AT3G24570 / 822053 AraportID:AT3G24570 Length:235 Species:Arabidopsis thaliana


Alignment Length:121 Identity:40/121 - (33%)
Similarity:59/121 - (48%) Gaps:6/121 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 VGVICHYWYKMLDK------RMPGRTMRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVW 180
            ||.:.|:||:.|||      |...::.|.||.|:.:|.||..|:.:..||..:|....|...||.
plant    91 VGPVGHFWYEGLDKFIKLKLRYVPKSTRFVAAKVAMDGLIFGPVDLLVFFTYMGFATGKNTAEVK 155

  Fly   181 EEIKEKAWKLYAAEWTVWPVAQFVNFYWIPTHYRIFYDNIISLGYDVLTSKVKHKQ 236
            |.:|.......|.|...||:.|..||.::|..|::.|.||..|......|.|:.::
plant   156 EGLKRDFLPALALEGGAWPLLQIANFRYVPVQYQLLYVNIFCLVDSAFLSWVEQQK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 20/63 (32%)
AT3G24570NP_189100.1 Mpv17_PMP22 144..205 CDD:397992 19/60 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2532
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.930

Return to query results.
Submit another query.