DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and AT2G14860

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_179092.1 Gene:AT2G14860 / 815975 AraportID:AT2G14860 Length:252 Species:Arabidopsis thaliana


Alignment Length:257 Identity:57/257 - (22%)
Similarity:98/257 - (38%) Gaps:42/257 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ARGLILSRAIRGQRSLRMSWPRNSSAT----GGAG--------------------GAAP----GG 45
            :|.|..:.|:...|.:|    ||::|:    |..|                    |.:|    |.
plant     2 SRALFRNVAVDTARLIR----RNAAASTDQYGKTGVAQSRPYFRSRQLLERAKETGVSPSPSLGF 62

  Fly    46 GSSTTTSTIGFGALQKLREWHASAFSSRFLLFTNVGISLTLSCVGDVLEQHLEIYCGEIERFEST 110
            .||::.|.|||..      |:.....|..::..:|..|| :....|:..|  .|.....|.::..
plant    63 SSSSSPSRIGFVG------WYLGMVKSHPVVTKSVTSSL-IYIAADLSSQ--TIAKTSSESYDLV 118

  Fly   111 RTAHMAISGVTV-GVICHYWYKMLDKRMPGRTMRVVAKKIVLDQLICSPIYISAFFVTLGLLEQK 174
            |||.|...|:.| |...|||:..:.:..|.:.:....||:.:.|.|..||....||.....|:.:
plant   119 RTARMGGYGLFVLGPTLHYWFNFMSRLFPKQDLITTFKKMAMGQTIYGPIMTVIFFSLNASLQGE 183

  Fly   175 TKHEVWEEIKEKAWKLYAAEWTVWPVAQFVNFYWIPTHYRIFYDNIISLGYDVLTSKVKHKQ 236
            ....:...:|.............||:..|:.|.:.|.|.:....|..|..:.:..:.:.:::
plant   184 RGSVILARLKRDLLPALFNGVMYWPLCDFITFRFFPVHLQPLVSNSFSYVWTIYMTYMANRE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 10/63 (16%)
AT2G14860NP_179092.1 Mpv17_PMP22 180..243 CDD:282035 10/62 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.