powered by:
Protein Alignment CG1662 and AT4G14301
DIOPT Version :9
| Sequence 1: | NP_001285209.1 |
Gene: | CG1662 / 32296 |
FlyBaseID: | FBgn0030481 |
Length: | 245 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001154231.1 |
Gene: | AT4G14301 / 6240440 |
AraportID: | AT4G14301 |
Length: | 132 |
Species: | Arabidopsis thaliana |
| Alignment Length: | 34 |
Identity: | 12/34 - (35%) |
| Similarity: | 14/34 - (41%) |
Gaps: | 8/34 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 32 SSATGGAGGAAPGGGSSTTTSTIGFGALQKLREW 65
|...|..||...||| || |.:.|.:.|
plant 75 SKGGGFGGGIGKGGG-------IG-GGIGKGKGW 100
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG1662 | NP_001285209.1 |
Mpv17_PMP22 |
170..234 |
CDD:282035 |
|
| AT4G14301 | NP_001154231.1 |
None |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1944 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.
