DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and si:ch211-120k19.1

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001313499.1 Gene:si:ch211-120k19.1 / 563199 ZFINID:ZDB-GENE-100922-282 Length:231 Species:Danio rerio


Alignment Length:166 Identity:49/166 - (29%)
Similarity:79/166 - (47%) Gaps:20/166 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 TNVGISLTLSCVGDVLEQHLEIYCGEIERFESTRTAHMAISGVTVGVIC------HYWYKMLDKR 136
            ||...:.|||.:..|.:.|...       .:.::||.:|:.|     .|      :||.:.|::.
Zfish    76 TNDAGNQTLSEMQHVPQFHRSF-------IDWSQTARVALVG-----FCFHANFNYYWLRGLERM 128

  Fly   137 MPGRTMRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAEWTVWPVA 201
            .||...:.|:.|::|||||.:|:.||||::.|..||  ...:.:|:.|.|.|..|......|...
Zfish   129 FPGGGTKRVSLKVILDQLIAAPMTISAFYIGLSTLE--GAEDPFEDWKNKFWTSYKTGVVYWSTM 191

  Fly   202 QFVNFYWIPTHYRIFYDNIISLGYDVLTSKVKHKQS 237
            |.|||..||...|..:...::||:.:.....|.::|
Zfish   192 QAVNFSLIPPAARTVFVGGVALGWTIFLCHFKQQKS 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 17/63 (27%)
si:ch211-120k19.1NP_001313499.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.