DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG1662 and 42Sp50

DIOPT Version :9

Sequence 1:	NP_001285209.1	Gene:	CG1662 / 32296	FlyBaseID:	FBgn0030481	Length:	245	Species:	Drosophila melanogaster
Sequence 2:	NP_001011438.1	Gene:	42Sp50 / 496924	XenbaseID:	XB-GENE-5853280	Length:	463	Species:	Xenopus tropicalis

Alignment Length:	57	Identity:	17/57 - (29%)
Similarity:	22/57 - (38%)	Gaps:	10/57 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly    37 GAGGAAPGG---------GSSTTTSTIGFGALQKLREWHASAFSSRFLLFTNVGISL 84
            |..|..|.|         |.:.|.:..||.|..|..|.|.....:.|..| |||.::
Frog   260 GGIGTVPVGKIETGILKPGMTITFAPSGFAAEVKSIEMHHEPLQTAFPGF-NVGFNV 315

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG1662	NP_001285209.1	Mpv17_PMP22	170..234	CDD:282035
42Sp50	NP_001011438.1	PTZ00141	7..447	CDD:185474	17/57 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1944
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900