DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and pxmp2

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001006885.1 Gene:pxmp2 / 448721 XenbaseID:XB-GENE-951886 Length:193 Species:Xenopus tropicalis


Alignment Length:165 Identity:39/165 - (23%)
Similarity:84/165 - (50%) Gaps:15/165 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LFTNVGISLTLSCVGDVLEQHLEIYCGEIERFESTRTAHMAISG---------VTVGVICHYWYK 131
            :.|....|..||.:|::|.|.::.:     |.|.....::.:.|         :..|.:.||:|.
 Frog    31 VLTKALTSAILSALGNILSQTIQKW-----RKEQKHPQNVDLRGPLRFAVYGLLFTGPLSHYFYL 90

  Fly   132 MLDKRMPGRTMRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAEWT 196
            :|::.:|........:::::::||.:|.::..||:.:.|||.|...::.:::|...|:.....|.
 Frog    91 LLEQLVPSSAPLAGLQRLLIERLIIAPAFLLLFFLVMNLLEGKNFTKLNQKLKSSYWQALKLNWK 155

  Fly   197 VWPVAQFVNFYWIPTHYRIFYDNIIS-LGYDVLTS 230
            ||...||:|..::|..:|:.:.|::: ..|..|:|
 Frog   156 VWTPFQFININYVPVQFRVLFANLVAFFWYAYLSS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 18/62 (29%)
pxmp2NP_001006885.1 Mpv17_PMP22 128..189 CDD:309301 16/60 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.