DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and mpv17l2

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001004930.1 Gene:mpv17l2 / 448319 XenbaseID:XB-GENE-1002324 Length:222 Species:Xenopus tropicalis


Alignment Length:172 Identity:64/172 - (37%)
Similarity:105/172 - (61%) Gaps:10/172 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 FSSRFLLFTNVGISLTLSC-----VGDVLEQHLEIYCGEIERFESTRTAHMAISGVTVGVICHYW 129
            |..|||:.||     |:||     :||.::|..|:......:.:..||..|...|.::|.:.|:|
 Frog    20 FKGRFLIVTN-----TVSCGLLLGIGDSIQQSREVRRDPERKRDWLRTGRMFAIGCSMGPLMHFW 79

  Fly   130 YKMLDKRMPGRTMRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAE 194
            |..||:..|||.:.||.:|:::|||:.||:....:|:.:|.:|.:...:.|:|.:||.|:.|.|:
 Frog    80 YSWLDRSFPGRGITVVMRKVLIDQLVASPVLGLWYFLGMGSMEGQKLEKSWQEFREKFWEFYKAD 144

  Fly   195 WTVWPVAQFVNFYWIPTHYRIFYDNIISLGYDVLTSKVKHKQ 236
            |||||.||.:|||::...||:.|.|:|::|:|...|.:||::
 Frog   145 WTVWPAAQMINFYFLSPKYRVIYINVITVGWDTYLSYLKHRK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 26/63 (41%)
mpv17l2NP_001004930.1 Mpv17_PMP22 119..180 CDD:367825 26/60 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I8960
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13093
Inparanoid 1 1.050 147 1.000 Inparanoid score I4305
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 1 1.000 - - FOG0003674
OrthoInspector 1 1.000 - - mtm9359
Panther 1 1.100 - - LDO PTHR11266
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 1 1.000 - - X2546
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.