DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and pxmp2

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001004607.1 Gene:pxmp2 / 447868 ZFINID:ZDB-GENE-040912-184 Length:194 Species:Danio rerio


Alignment Length:167 Identity:45/167 - (26%)
Similarity:86/167 - (51%) Gaps:6/167 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RFLLFTNVGISLTLSCVGDVLEQHLEIYCGEIERFESTRTA-----HMAISGVTV-GVICHYWYK 131
            ::.:.|....|..||.:|::|.|.||......|.....:.:     |.||.|:.: |.:.||:|.
Zfish    27 KYPIITKSVTSGILSALGNLLSQVLEYQKNVKENSPKKKISILGPVHFAIYGLFITGPVSHYFYH 91

  Fly   132 MLDKRMPGRTMRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAEWT 196
            :|:..:|......:.|:::|::||.:|.::..|:|.:..||.||..:|..::|...|......|.
Zfish    92 LLEVLLPTTVPYCLIKRLLLERLIFAPAFLLLFYVVMNALEGKTLADVQNKLKTSYWPAMKMNWK 156

  Fly   197 VWPVAQFVNFYWIPTHYRIFYDNIISLGYDVLTSKVK 233
            ||...||:|..::|..:|:.:.|:::|.:....:.|:
Zfish   157 VWTPFQFININYVPVQFRVLFANMVALFWYAYLASVR 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 18/64 (28%)
pxmp2NP_001004607.1 Mpv17_PMP22 131..194 CDD:282035 18/63 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.