DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and mpv17l2

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001002567.1 Gene:mpv17l2 / 436840 ZFINID:ZDB-GENE-040718-306 Length:199 Species:Danio rerio


Alignment Length:173 Identity:65/173 - (37%)
Similarity:102/173 - (58%) Gaps:10/173 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 FSSRFLLFTNVGISLTLSC-----VGDVLEQHLEIYCGEIERFESTRTAHMAISGVTVGVICHYW 129
            |..|||:.||     |:||     .||:::|..||........:.:||..|...|.::|...|||
Zfish    21 FRGRFLIVTN-----TVSCGGMLAAGDLIQQTREIRRTPGRTRDWSRTGCMFAVGCSMGPFMHYW 80

  Fly   130 YKMLDKRMPGRTMRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAE 194
            |:.|||...|..:..|.||:::|||:.||...:.:|:.:|::|..|..|..:|.::|.|:.|.|:
Zfish    81 YQWLDKYFIGNGINNVCKKVLVDQLVASPTLGAWYFLGMGMMEGHTFIEAQQEFRDKFWEFYKAD 145

  Fly   195 WTVWPVAQFVNFYWIPTHYRIFYDNIISLGYDVLTSKVKHKQS 237
            |.|||.||.:|||::|..:|:.|.||::||:|...|.:||:.:
Zfish   146 WCVWPAAQMINFYFLPPKFRVLYVNIVTLGWDTYLSYLKHRDT 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 26/63 (41%)
mpv17l2NP_001002567.1 Mpv17_PMP22 121..185 CDD:282035 26/63 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580471
Domainoid 1 1.000 71 1.000 Domainoid score I9406
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13093
Inparanoid 1 1.050 132 1.000 Inparanoid score I4597
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 1 1.000 - - FOG0003674
OrthoInspector 1 1.000 - - otm25042
orthoMCL 1 0.900 - - OOG6_100380
Panther 1 1.100 - - LDO PTHR11266
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 1 1.000 - - X2546
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.