DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and plh

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_649511.2 Gene:plh / 40615 FlyBaseID:FBgn0037292 Length:193 Species:Drosophila melanogaster


Alignment Length:160 Identity:35/160 - (21%)
Similarity:68/160 - (42%) Gaps:12/160 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 TLSCVGDVLEQHLEIYCGEIER-----FESTRTAHMAISG-VTVGVICHYWYKMLDKRMPGRTMR 143
            ||...|.::||.:      ||:     ::..:....::.| ..:|...:.|.::.....|...::
  Fly    23 TLWPCGSLIEQTM------IEKKTFRTYDWMKCLRFSLFGFFFMGPTIYVWIRLASVMWPRTDIK 81

  Fly   144 VVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAEWTVWPVAQFVNFYW 208
            ....|.:.:|....|:.||:|...:.|:|..:..|...|:.:|....|......||..|.|||.:
  Fly    82 SSLCKAITEQTAYDPMAISSFLFFMTLMEGNSYAEAKREVSDKFLDAYKVGVIYWPCVQTVNFAF 146

  Fly   209 IPTHYRIFYDNIISLGYDVLTSKVKHKQSH 238
            :|...::.:.:..|:.:....:.||..|.|
  Fly   147 VPARNQVVFTSFFSMCWTTFLAYVKFLQLH 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 15/63 (24%)
plhNP_649511.2 Mpv17_PMP22 108..171 CDD:282035 14/62 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463151
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.