DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1662 and mpv17

DIOPT Version :9

Sequence 1:NP_001285209.1 Gene:CG1662 / 32296 FlyBaseID:FBgn0030481 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_957459.2 Gene:mpv17 / 394140 ZFINID:ZDB-GENE-040426-1168 Length:177 Species:Danio rerio


Alignment Length:174 Identity:52/174 - (29%)
Similarity:80/174 - (45%) Gaps:23/174 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FGALQKLREWHASAFSSRFLLFTNVGISLTLSCVGDVLEQHLEIYCGEIER-----FESTRTAH- 114
            :.||.....|.....::..|    ||       ||||:.|.|      |||     ..:.|||. 
Zfish     8 YQALMAKHPWKVQIITAGSL----VG-------VGDVISQQL------IERRGLANHNARRTAKM 55

  Fly   115 MAISGVTVGVICHYWYKMLDKRMPGRTMRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEV 179
            |:|....||.:...|||:|||.:.|.|.....||:::||:..:|.::.||....|.|...|..|.
Zfish    56 MSIGFFFVGPVVGGWYKVLDKLVTGGTKSAALKKMLVDQVGFAPCFLGAFLGITGTLNGLTVEEN 120

  Fly   180 WEEIKEKAWKLYAAEWTVWPVAQFVNFYWIPTHYRIFYDNIISL 223
            ..:::........:.:.:||..|..|||:||.|:|:....|:::
Zfish   121 VAKLQRDYTDALISNYYLWPPVQIANFYFIPLHHRLAVVQIVAV 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1662NP_001285209.1 Mpv17_PMP22 170..234 CDD:282035 14/54 (26%)
mpv17NP_957459.2 Mpv17_PMP22 112..175 CDD:282035 14/53 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100380
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3951
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.